General Information

  • ID:  hor000350
  • Uniprot ID:  A0A1S4FV87
  • Protein name:  MIP-2
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AWNKINGGW
  • Length:  9(136-144)
  • Propeptide:  MINQHLILWTNFGKLLLLLVLCSLVSNIQTESASLEQHQMEHADESTHSHSPQKRTWKNLQGGWGKRTPTSEQPDPNADYYGYTGRNDDTADYGNAENELDKLNKYLIKGLINQRLAQLDTQYDGSDEEYPVEKRAWNKINGGWGKRVNAGPAQWNKFRGSWGKREPGWNNLKGLWGKRSEKWNKLSSSWGKRDSGNSNSY
  • Signal peptide:  MINQHLILWTNFGKLLLLLVLCSLVSNIQT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000350_AF2.pdbhor000350_ESM.pdb

Physical Information

Mass: 118805 Formula: C49H68N14O12
Absent amino acids: CDEFHLMPQRSTVY Common amino acids: GNW
pI: 9.7 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -80 Boman Index: -556
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.44
Instability Index: 5020 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti